UBE2C monoclonal antibody (M01), clone 9D3

• Catalog Number: orb2291452
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant UBE2C.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 9D3
• Tested applications: ELISA, IF, IHC-P, WB
• Reactivity: Human
• Isotype: IgG2a Kappa
• Immunogen: UBE2C (NP_008950, 70 a.a. ~ 179 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: AGTVYEDLRYKLSLEFPSGYPYNAPTVKFLTPCYHPNVDTQGNICLDILKEKWSALYDVRTILLSIQSLLGEPNIDSPLNTHAAELWKNPTAFKKYLQETYSKQVTSQEP
• NCBI: NP_008950
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged UBE2C is approximately 0.03 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to UBE2C on HeLa cell. [antibody concentration 10 ug/ml]

Immunoperoxidase of monoclonal antibody to UBE2C on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml]

UBE2C monoclonal antibody (M01), clone 9D3 Western Blot analysis of UBE2C expression in HeLa.

Western Blot analysis of UBE2C expression in transfected 293T cell line by UBE2C monoclonal antibody (M01), clone 9D3. Lane 1: UBE2C transfected lysate(19.7 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (37.84 KDa).