You have no items in your shopping cart.
Cart summary
UBE2A Peptide - N-terminal region
Catalog Number: orb1997751
| Catalog Number | orb1997751 |
|---|---|
| Category | Proteins |
| Description | UBE2A Peptide - N-terminal region |
| Predicted Reactivity | Human |
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized powder |
| Protein Sequence | Synthetic peptide located within the following region: DFKRLQEDPPAGVSGAPSENNIMVWNAVIFGPEGTPFEDGTFKLTIEFTE |
| UniProt ID | Q9Z255 |
| MW | 17 kDa |
| Storage | Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles. |
| Alternative names | UBC2, HHR6A, MRXSN, RAD6A, MRXS30 |
| Note | For research use only |
| NCBI | NP_001269090.1 |
