Cart summary

You have no items in your shopping cart.

UBA7 Peptide - middle region

UBA7 Peptide - middle region

Catalog Number: orb1998852

DispatchUsually dispatched within 5-10 working days
$ 230.00
Catalog Numberorb1998852
CategoryProteins
DescriptionUBA7 Peptide - middle region
Predicted ReactivityHuman
Form/AppearanceLyophilized powder
Buffer/PreservativesLyophilized powder
Protein SequenceSynthetic peptide located within the following region: QEVHHAHCLHQAFCALHKFQHLHGRPPQPWDPVDAETVVGLARDLEPLKR
UniProt IDP41226
MW111 kDa
StorageAdd 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Alternative namesD8, UBE2, UBA1B, UBE1L
NoteFor research use only
NCBINP_003326.2