You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2694883 |
---|---|
Category | Proteins |
Description | (Tyr0)-Urocortin, rat is a high-affinity agonist of corticotropin-releasing factor receptor type 1 (CRF-R1) and type 2 (CRF-R2). (Tyr0)-Urocortin, rat shows inhibitory binding constants (Ki) of 1-2 nM. |
Target | CRFR |
Purity | ≥95% |
Protein Sequence | YDDPPLSIDLTFHLLRTLLELARTQSQRERAEQNRIIFDSV-NH2 |
MW | 4870.55 |
CAS Number | 187111-93-9 |
Formula | C215H347N63O66 |
Note | For research use only |