You have no items in your shopping cart.
Cart summary
TNFRSF11A Peptide - C-terminal region
Catalog Number: orb2000402
| Catalog Number | orb2000402 |
|---|---|
| Category | Proteins |
| Description | TNFRSF11A Peptide - C-terminal region |
| Predicted Reactivity | Human |
| Form/Appearance | Lyophilized powder |
| MW | 37 kDa |
| UniProt ID | Q9Y6Q6 |
| Protein Sequence | Synthetic peptide located within the following region: PSSARAGAGSGSSPGGQSPASGNVTGNSNSTFISSGQVMNFKGDIIVVYV |
| NCBI | NP_001257878.1 |
| Storage | Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles. |
| Buffer/Preservatives | Lyophilized powder |
| Alternative names | FEO, OFE, ODFR, OSTS, PDB2, RANK, CD265, OPTB7, TR Read more... |
| Note | For research use only |
| Application notes | This is a synthetic peptide designed for use in combination with TNFRSF11A Rabbit Polyclonal Antibody (orb589374). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. |
| Expiration Date | 6 months from date of receipt. |
