You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2292055 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant TGM2. |
Species/Host | Mouse |
Clonality | Monoclonal |
Clone Number | 2F4 |
Tested applications | ELISA, IF, IHC-P, WB |
Reactivity | Human |
Isotype | IgG2a Kappa |
Immunogen | TGM2 (AAH03551, 1 a.a. ~ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Conjugation | Unconjugated |
Protein Sequence | MAEELVLERCDLELETNGRDHHTADLCREKLVVRRGQPFWLTLHFEGRNYEASVDSLTFSVVTGPAPSQEAGTKARFPLRDAVEEGDWTATVVDQQDCTLSLQLTTPANAPIGLYRLSLE |
NCBI | AAH03551 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Detection limit for recombinant GST tagged TGM2 is approximately 0.03 ng/ml as a capture antibody.
Immunofluorescence of monoclonal antibody to TGM2 on HeLa cell. [antibody concentration 10 ug/ml]
Immunoperoxidase of monoclonal antibody to TGM2 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml]
Western Blot analysis of TGM2 expression in transfected 293T cell line by TGM2 monoclonal antibody (M10), clone 2F4. Lane 1: TGM2 transfected lysate (61.7 KDa). Lane 2: Non-transfected lysate.
Western Blot detection against Immunogen (38.83 KDa).