You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2008745 |
---|---|
Category | Proteins |
Description | TDGF1 Peptide - middle region |
Tested applications | WB |
Predicted Reactivity | Human |
Form/Appearance | Lyophilized powder |
MW | 21kDa |
UniProt ID | P13385 |
Protein Sequence | LRCFPQAFLPGCDGLVMDEHLVASRTPELPPSARTTTFMLVGICLSIQSY |
NCBI | NP_003203 |
Storage | Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles. |
Buffer/Preservatives | Lyophilized powder |
Alternative names | CR, CRGF, CRIPTO, Cripto-1 Read more... |
Note | For research use only |
Application notes | This is a synthetic peptide designed for use in combination with TDGF1 Rabbit Polyclonal Antibody (orb330414). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. |
Expiration Date | 6 months from date of receipt. |