STAT5B Rabbit Polyclonal Antibody

• Catalog Number: orb576926
• Category: Antibodies
• Description: Rabbit polyclonal antibody to STAT5B
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human STAT5B
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 90kDa
• Target: STAT5B
• UniProt ID: P51692
• Protein Sequence: Synthetic peptide located within the following region: AVWIQAQQLQGEALHQMQALYGQHFPIEVRHYLSQWIESQAWDSVDLDNP
• NCBI: NP_036580
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: STAT5, GHISID2
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Anti-STAT5B antibody IHC staining of human placenta. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.

Anti-STAT5B antibody IHC staining of human prostate. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.

Rabbit Anti-STAT5B Antibody, Paraffin Embedded Tissue: Human Testis, Antibody Concentration: 5 ug/ml.

WB Suggested Anti-STAT5B Antibody Titration: 1 ug/ml, Positive Control: 293T cells lysate. There is BioGPS gene expression data showing that STAT5B is expressed in HEK293T.