SMARCE1 Rabbit Polyclonal Antibody

• Catalog Number: orb576579
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SMARCE1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SMARCE1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 47kDa
• Target: SMARCE1
• UniProt ID: Q969G3
• Protein Sequence: Synthetic peptide located within the following region: MSKRPSYAPPPTPAPATQMPSTPGFVGYNPYSHLAYNNYRLGGNPGTNSR
• NCBI: NP_003070
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: CSS5, BAF57
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Human kidney

Lane 1: HeLa (human), Lane 2: NHEM (human), Lane 3: Melba (mouse), Lane 4: NIH3T3 (mouse), Lane 5: S16 (rat), Lane 6: H9C2 (rat), Primary Antibody Dilution: 1:500, Secondary Antibody: Donkey anti-rabbit-HRP, Secondary Antibody Dilution: 1:5000, Gene Name: SMARCE1.

Rabbit Anti-SMARCE1 antibody, Paraffin Embedded Tissue: Human Lung, cell Cellular Data: alveolar cell, Antibody Concentration: 4.0-8.0 ug/ml Magnification: 400X.

WB Suggested Anti-SMARCE1 Antibody Titration: 0.2-1 ug/ml, Positive Control: Jurkat cell lysate. SMARCE1 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells.