You have no items in your shopping cart.
Cart summary
Item 1 of 1
Scaf8 Rabbit Polyclonal Antibody
Catalog Number: orb324901
| Catalog Number | orb324901 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to Scaf8 |
| Species/Host | Rabbit |
| Clonality | Polyclonal |
| Tested applications | WB |
| Predicted Reactivity | Bovine, Canine, Equine, Human, Porcine, Rabbit, Rat, Zebrafish |
| Reactivity | Mouse |
| Concentration | 0.5 mg/ml |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Conjugation | Unconjugated |
| MW | 139kDa |
| Target | Scaf8 |
| UniProt ID | Q6DID3 |
| Protein Sequence | Synthetic peptide located within the following region: VAPAVPAVSLVPPAFPVSMPVPPPGFNPIPPPPFLRASFNPSQPPPGFMP |
| NCBI | NP_598884 |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Alternative names | anti A630086M08Rik antibody, anti A930036P18Rik an Read more... |
| Note | For research use only |
| Expiration Date | 12 months from date of receipt. |
WB Suggested Anti-Scaf8 Antibody, Titration: 1.0 ug/mL, Positive Control: Mouse Kidney.
- Item 1 of 2
RBM16 Rabbit Polyclonal Antibody [orb312885]
IF, IHC-Fr, IHC-P
Human, Mouse, Rabbit
Rat
Rabbit
Polyclonal
Unconjugated
100 μl, 50 μl, 200 μl - Item 1 of 2
- Item 1 of 1
- Item 1 of 2
- Item 1 of 1
