You have no items in your shopping cart.
You have no items in your shopping cart.

| Catalog Number | orb1272800 |
|---|---|
| Category | Antibodies |
| Description | SARS-CoV-2 (COVID-19) ORF8 protein polyclonal antibody |
| Clonality | Polyclonal |
| Isotype | IgG |
| Conjugation | Unconjugated |
| Reactivity | Virus |
| Form/Appearance | Liquid |
| Concentration | batch dependent |
| Buffer/Preservatives | PBS, pH 7.4, containing 0.05% proclin300, 50% glycerol. |
| Immunogen | MKFLVFLGIITTVAAFHQECSLQSCTQHQPYVVDDPCPIHFYSKWYIRVGARKSAPLIELCVDEAGSKSPIQYIDIGNYTVSCLPFTINCQEPKLGSLVVRCSFYEDFLEYHDVRVVLDFI |
| Tested applications | ELISA |
| Application notes | Elisa:1:4000~1:8000 |
| Antibody Type | Primary Antibody |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | Non-structural protein 8,ns8,ORF8 protein |
| Research Area | Infectious Disease & Virology |
| Note | For research use only |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review