SARS-CoV-2 (COVID-19) ORF8 protein polyclonal antibody

• Catalog Number: orb1272800
• Category: Antibodies
• Description: SARS-CoV-2 (COVID-19) ORF8 protein polyclonal antibody
• Clonality: Polyclonal
• Isotype: IgG
• Conjugation: Unconjugated
• Reactivity: Virus
• Form/Appearance: Liquid
• Concentration: batch dependent
• Buffer/Preservatives: PBS, pH 7.4, containing 0.05% proclin300, 50% glycerol.
• Immunogen: MKFLVFLGIITTVAAFHQECSLQSCTQHQPYVVDDPCPIHFYSKWYIRVGARKSAPLIELCVDEAGSKSPIQYIDIGNYTVSCLPFTINCQEPKLGSLVVRCSFYEDFLEYHDVRVVLDFI
• Tested applications: ELISA
• Application notes: Elisa:1:4000~1:8000
• Antibody Type: Primary Antibody
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: Non-structural protein 8,ns8,ORF8 protein
• Research Area: Infectious Disease & Virology
• Note: For research use only