SAFB monoclonal antibody (M04), clone 5A11

• Catalog Number: orb2292212
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant SAFB.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 5A11
• Tested applications: ELISA, IF, IHC-P, WB
• Reactivity: Human
• Isotype: IgG2b Kappa
• Immunogen: SAFB (NP_002958, 111 a.a. ~ 200 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: DGQEDVETSLENLQDIDIMDISVLDEAEIDNGSVADCVEDDDADNLQESLSDSRELVEGEMKELPEQLQEHAIEDKETINNLDTSSSDFT
• NCBI: NP_002958
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged SAFB is approximately 0.1 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to SAFB on HeLa cell. [antibody concentration 10 ug/ml]

Immunoperoxidase of monoclonal antibody to SAFB on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3 ug/ml]

SAFB monoclonal antibody (M04), clone 5A11 Western Blot analysis of SAFB expression in Hela S3 NE.

Western Blot detection against Immunogen (35.64 KDa).