RYMV P1 Antibody

• Catalog Number: orb334975
• Category: Antibodies
• Description: Goat polyclonal antibody to P1 protein from rice yellow mottle virus (RYMV). P1 protein is a product from the gene ORF1. This protein has a possible role in suppression of post-transcriptional gene silencing and viral movement.
• Target: RYMV P1
• Clonality: Polyclonal
• Species/Host: Goat
• Isotype: IgG
• Conjugation: Unconjugated
• Reactivity: Virus
• Concentration: 1 mg/ml
• Buffer/Preservatives: PBS, 20% glycerol and 0.05% sodium azide
• Purification: Epitope affinity purified
• Immunogen: Antigen: Purified recombinant peptide derived from within residues 55 aa to N-terminal of RYMV P1 produced in E. coli.. Antigen Sequence: MTRLEVLIRPTEQTVAKAIAVGYTHTLTWVWYPQTWDVDSVNDPVLRADFDPDRAG
• Tested applications: WB
• Dilution range: WB:1:500-1:2,000
• Application notes: The antibody solution should be gently mixed before use.
• Antibody Type: Primary Antibody
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: P1 (ORF1), RYMV, Rice Yellow Mottle Virus antibody
• Note: For research use only

Western blot analysis of staining of MBP-RYMV P1 N-term recombinant protein and HEK293 transfected cell lysate using RYMV P1 antibody