Rorc Rabbit Polyclonal Antibody

• Catalog Number: orb329909
• Category: Antibodies
• Description: Rabbit polyclonal antibody to Rorc
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Canine, Guinea pig, Human, Rat
• Reactivity: Mouse
• Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 58kDa
• Target: Rorc
• UniProt ID: P51450
• Protein Sequence: Synthetic peptide located within the following region: VKFGRMSKKQRDSLHAEVQKQLQQQQQQEQVAKTPPAGSRGADTLTYTLG
• NCBI: NP_035411
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti Nr1f3 antibody, anti RORgamma antibody, anti
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

WB Suggested Anti-Rorc Antibody Titration: 1 ug/mL, Positive Control: Mouse Heart lysate.