RecombinantTSG,His,Human

• Catalog Number: orb1494621
• Category: Proteins
• Description: Twisted gastrulation (TWSG1 or TSG) is a cysteine-rich 24 kDa glycoprotein. It is a secreted BMP binding protein that modulates BMP ligand availability in extracellular space. Human TSG shares 98% aa identity with mouse and rat TSG, and 99.5% aa identity with canine, equine, bovine and porcine TSG. Glycosylation and bioactivity of TWSG1 recombinant proteins vary markedly by cellular source. Non-glycosylated hTWSG1 made in E. coli has both reduced affinity for BMPs, as shown by surface plasmon resonance analysis, and reduced BMP inhibitory activity in a mandibular explant culture system compared to glycosylated proteins made in insect cells or mouse myeloma cells.Recombinant human Twisted Gastrulation (TSG), produced in HEK 293 cells is a polypeptide chain containing 211 amino acids. A fully biologically active molecule, rhTSG has a molecular mass of 30~33 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript.
• Form/Appearance: Lyophilized after extensive dialysis against PBS.
• Purity: > 95% as analyzed by SDS-PAGE and HPLC.
• MW: 30-33 kDa, observed by reducing SDS-PAGE.
• Protein Sequence: HHHHHHHHCNKALCASDVSKCLIQELCQCRPGEGNCSCCKECMLCLGALWDECCDCVGMCNPRNYSDT PPTSKSTVEELHEPIPSLFRALTEGDTQLNWNIVSFPVAEELSHHENLVSFLETVNQPHH QNVSVPSNNVHAPYSSDKEHMCTVVYFDDCMSIHQCKISCESMGASKYRWFHNACCECIG PECIDYGSKTVKCMNCMF
• Source: HEK 293
• Biological Activity: Determined by its ability to neutralize BMP-6 induced alkaline phosphatase production by ATDC-5 chondrogenic cells. The ED50 for this effect is < 2 μg/ml of TSG.
• Endotoxins: < 0.2 EU/μg, determined by LAL method.
• Storage: Lyophilized recombinant Human Twisted Gastrulation (TSG), remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human Twisted Gastrulation should be stable up to 1 week at 4°C or up to 2 months at -20°C.
• Buffer/Preservatives: Lyophilized after extensive dialysis against PBS.
• Alternative names: Twisted Gastrulation Protein
• Note: For research use only
• Application notes: Reconstituted in ddH2O or PBS at 100 μg/ml.
• Expiration Date: 6 months from date of receipt.