Cart summary

You have no items in your shopping cart.

RecombinantMCP-1/CCL2,Rat

RecombinantMCP-1/CCL2,Rat

Catalog Number: orb1494632

DispatchUsually dispatched within 5-10 working days
$ 200.00
Catalog Numberorb1494632
CategoryProteins
DescriptionChemokine (C-C motif) ligand 2 (CCL2) is also referred to as monocyte chemotactic protein 1 (MCP1) and small inducible cytokine A2. CCL2 is a small cytokine that belongs to the CC chemokine family. CCL2 recruits monocytes, memory T cells, and dendritic cells to the sites of inflammation produced by either tissue injury or infection. CCL2 is implicated in the pathogeneses of several diseases characterized by monocytic infiltrates, such as psoriasis, rheumatoid arthritis and atherosclerosis. CCL2 is anchored in the plasma membrane of endothelial cells by glycosaminoglycan side chains of proteoglycans. CCL2 is primarily secreted by monocytes, macrophages and dendritic cells. CCL2 can signal through the CCR2 receptor.Recombinant rat MCP-1/CCL2 produced in HEK293 cells is a polypeptide chain containing 125 amino acids. A fully biologically active molecule, rrMCP-1/CCL2 has a molecular mass of 10-15 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript.
Form/AppearanceLyophilized after extensive dialysis against PBS.
Purity> 98% as analyzed by SDS-PAGE.
MW10~15 kDa, observed by reducing SDS-PAGE.
Protein SequenceQPDAVNAPLTCCYSFTGKMIPMSRLENYKRITSSRCPKEAVVFVTKLKREICADPNKEWV QKYIRKLDQNQVRSETTVFYKIASTLRTSAPLNVNLTHKSEANASTLFSTTTSSTSVEVT SMTEN
SourceHEK 293
Biological ActivityThe EC50 value of rat MCP-1/CCL2 on Caˆ2+ mobilization assay in CHO-K1/G15/rCCR2 cells (human G15 and rat CCR2 stably expressed in CHO-K1 cells) is less than 0.3 μg/ml.
Endotoxins< 0.2 EU/μg, determined by LAL method.
StorageLyophilized recombinant Rat MCP-1°CCL2 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Rat MCP-1°CCL2 should be stable up to 1 week at 4°C or up to 3 months at -20°C.
Buffer/PreservativesLyophilized after extensive dialysis against PBS.
Alternative namesMCP-1; Monocyte Chemotactic Protein-1, CCL2, MCAF
Read more...
NoteFor research use only
Application notesReconstituted in ddH2O or PBS at 100 μg/ml.
Expiration Date6 months from date of receipt.