You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1494633 |
---|---|
Category | Proteins |
Description | Chemokine (C-C motif) ligand 2 (CCL2) is also referred to as monocyte chemotactic protein 1 (MCP1) and small inducible cytokine A2. CCL2 is a small cytokine that belongs to the CC chemokine family. CCL2 recruits monocytes, memory T cells, and dendritic cells to the sites of inflammation produced by either tissue injury or infection. CCL2 is implicated in the pathogeneses of several types of disease characterized by monocytic infiltrates, such as psoriasis, rheumatoid arthritis and atherosclerosis. CCL2 is anchored in the plasma membrane of endothelial cells by glycosaminoglycan side chains of proteoglycans. CCL2 is primarily secreted by monocytes, macrophages and dendritic cells. CCL2 can signal through the CCR2 receptor.Recombinant mouse MCP-1/CCL2 produced in HEK293 cells is a polypeptide chain containing 73 amino acids. A fully biologically active molecule, rmMCP-1/CCL2 has a molecular mass of 8 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript. |
Form/Appearance | Lyophilized after extensive dialysis against PBS. |
Purity | > 98% as analyzed by SDS-PAGE. |
MW | 8 kDa, observed by reducing SDS-PAGE. |
Protein Sequence | QPDAVNAPLTCCYSFTSKMIPMSRLESYKRITSSRCPKEAVVFVTKLKREVCADPKKEWVQTYIKNLDRNQMR |
Source | HEK 293 |
Biological Activity | The EC50 value of mouse MCP-1/CCL2 on Caˆ2+ mobilization assay in CHO-K1/Ga15/mCCR2 cells (human Ga15 and mouse CCR2 stably expressed in CHO-K1 cells) is less than 0.3 μg/ml. |
Endotoxins | < 0.2 EU/μg, determined by LAL method. |
Storage | Lyophilized recombinant Mouse MCP-1°CCL2 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Mouse MCP-1°CCL2 should be stable up to 1 week at 4°C or up to 3 months at -20°C. |
Buffer/Preservatives | Lyophilized after extensive dialysis against PBS. |
Alternative names | MCP-1; Monocyte Chemotactic Protein-1, CCL2, MCAF; Read more... |
Note | For research use only |
Application notes | Reconstituted in ddH2O or PBS at 100 μg/ml. |
Expiration Date | 6 months from date of receipt. |