You have no items in your shopping cart.
You have no items in your shopping cart.

| Catalog Number | orb1494634 |
|---|---|
| Category | Proteins |
| Description | Chemokine (C-X-C motif) ligand 11(CXCL11), also known as I-TAC and B-R1, is a small cytokine belonging to the CXC chemokine family that is also called Interferon-inducible T-cell alpha chemoattractant (I-TAC) and Interferon-gamma-inducible protein 9 (IP-9).This chemokine elicits its effects on target cells by interacting with chemokine receptor CXCR3 having a higher affinity than other ligands for this receptor such as CXCL9 and CXCL10. CXCL11 is chemotactic for activated T cells. The gene encoding CXCL11 has been mapped to chromosome 4. CXCL11 cDNA encodes a 94 amino acid residue precursor protein with a 21 amino acid residue putative signal sequence, which is cleaved to form the mature 73 amino acid residue protein. CXCL11 shares 36% and 37% amino acid sequence homology with IP-10 and MIG (two other known human non-ELR CXC chemokines), respectively. Mouse CXCL11 exhibits 68% sequence homology with human CXCL11.Recombinant human I-TAC/CXCL11 produced in HEK293 cells is a single non-glycosylated polypeptide chain containing 73amino acids. A fully biologically active molecule, rhI-TAC/CXCL11 has a molecular mass of 8.3 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript. |
| Form/Appearance | Lyophilized after extensive dialysis against PBS. |
| Buffer/Preservatives | Lyophilized after extensive dialysis against PBS. |
| Purity | > 98% as analyzed by SDS-PAGE. |
| Purification | > 98% as analyzed by SDS-PAGE. |
| Protein Sequence | FPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKIEVIITLKENKGQRCLNPKSKQ ARLIIKKVERKNF |
| MW | 8.3 kDa, observed by reducing SDS-PAGE. |
| Application notes | Reconstituted in ddH2O or PBS at 100μg/ml. |
| Endotoxins | < 0.2 EU/μg, determined by LAL method. |
| Source | HEK 293 |
| Biological Activity | The EC50 value of human I‑TAC/CXCL11 on Caˆ2+ mobilization assay in CHO-K1/Ga15/hCXCR3 cells (human Ga15 and human CXCR3 stably expressed in CHO-K1 cells) is less than 0.5 μg/ml. |
| Storage | Lyophilized recombinant humanI‑TAC/ CXCL11 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, humanCXCL11/I‑TAC should be stable up to 1 week at 4°C or up to 2 months at -20°C. |
| Alternative names | ITAC, CXCL11 |
| Note | For research use only |
| Expiration Date | 6 months from date of receipt. |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review