RecombinantIP-10/CRG-2/CXCL10,Rat

• Catalog Number: orb1494635
• Category: Proteins
• Description: C-X-C motif chemokine 10 (CXCL10) also known as interferon gamma-induced protein 10 (IP-10) or small-inducible cytokine B10, is originally identified as an IFN-γ-inducible gene in monocytes, fibroblasts and endothelial cells. It has since been shown that IP-10 mRNA is also induced by LPS, IL-1β, TNF-α, IL-12 and viruses. Additional cell types that have been shown to express IP-10 include activated T-lymphocytes, splenocytes, keratinocytes, osteoblasts, astrocytes, and smooth muscle cells. IP-10 is also expressed in psoriatic and lepromatous lesions of the skin. Recombinant rat IP-10/CRG-2/CXCL10 produced in HEK 293 cells is a polypeptide chain containing 77 amino acids. A fully biologically active molecule, rr IP-10/CRG-2/CXCL10 has a molecular mass of 8.7 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript.
• Form/Appearance: Lyophilized after extensive dialysis against PBS.
• Purity: > 98% as analyzed by SDS-PAGE.
• MW: 8.7 kDa, observed by reducing SDS-PAGE.
• Protein Sequence: IPLARTVRCTCIDFHEQPLRPRAIGKLEIIPASLSCPHVEIIATMKKNNEKRCLNPESEA IKSLLKAVSQRRSKRAP
• Source: HEK 293
• Biological Activity: The EC50 value of rat IP-10/CRG-2/CXCL10 on Caˆ2+ mobilization assay in CHO-K1/Gα15/rCXCR3 cells (human Gα15 and rat CXCR3 stably expressed in CHO-K1 cells) is less than 300 ng/ml.
• Endotoxins: < 0.2 EU/μg, determined by LAL method.
• Storage: Lyophilized recombinant Rat IP-10°CRG-2°CXCL10 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Rat IP-10°CRG-2°CXCL10 should be stable up to 1 week at 4°C or up to 3 months at -20°C.
• Buffer/Preservatives: Lyophilized after extensive dialysis against PBS.
• Alternative names: Small inducible cytokine B10, CXCL10, 10 kDa inter
• Note: For research use only
• Application notes: Reconstituted in ddH2O or PBS at 100 μg/ml.
• Expiration Date: 6 months from date of receipt.