RecombinantIL-6,Rat(HEK293-expressed)

• Catalog Number: orb1494636
• Category: Proteins
• Description: Interleukin-6 (IL-6) is a pleiotropic cytokine that plays an important role in host defense by regulating immune and inflammatory responses. Produced by T cells, monocytes, fibroblasts, endothelial cells and keratinocytes, Interleukin-6 (IL-6) has diverse biological functions. It stimulates B-cell differentiation and antibody production, synergizes with IL-3 in megakaryocyte development and platelet production, induces expression of hepatic acute-phase proteins, and regulates bone metabolism. Interleukin-6 (IL-6) signals through the IL-6 receptor system that consists of two chains, IL-6R alpha and gp130.
• Form/Appearance: Lyophilized after extensive dialysis against PBS.
• Purity: > 95% as analyzed by SDS-PAGE.
• MW: 21~26 kDa , observed by reducing SDS-PAGE.
• Protein Sequence: FPTSQVRRGDFTEDTTHNRPVYTTSQVGGLITYVLREILEMRKELCNGNSDCMNSDDALSENNLKLPEIQRNDGCFQTGY NQEICLLKICSGLLEFRFYLEFVKNNLQDNKKDKARVIQSNTETLVHIFKQEIKDSYKIVLPTPTSNALLMEKLESQKEW LRTKTIQLILKALEEFLKVTMRSTRQT
• Source: HEK 293
• Biological Activity: ED50 < 3 pg/ml, measured by a cell proliferation assay using 7TD1 Cells.
• Endotoxins: < 0.2 EU/μg, determined by LAL method.
• Storage: Lyophilized recombinant Rat Interleukin-6(IL-6) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, it should be stable up to 1 week at 4°C or up to 2 months at -20°C.
• Buffer/Preservatives: Lyophilized after extensive dialysis against PBS.
• Alternative names: Interleukin-6, IL6
• Note: For research use only
• Application notes: Reconstituted in ddH2O or PBS at 100 μg/ml.
• Expiration Date: 6 months from date of receipt.