You have no items in your shopping cart.
You have no items in your shopping cart.

| Catalog Number | orb1494638 |
|---|---|
| Category | Proteins |
| Description | Interleukin-22 (IL-22) is a member of the IL-10 family of regulatory cytokines which includes IL-10, IL-19, IL-20, IL-22, IL-24 and IL-26. Members of this family share partial homology in their amino acid sequences, but they are dissimilar in their biological functions. Produced by T lymphocytes, IL-22 inhibits IL-4 production by Th2 cells, and induces acute phase reactants in the liver and pancreas. IL-22 signals through a receptor system consisting of IL-10R-ß/CRF2-4 and IL-22R, both of which are members of the class II cytokine-receptor family. |
| Form/Appearance | Lyophilized after extensive dialysis against PBS. |
| Buffer/Preservatives | Lyophilized after extensive dialysis against PBS. |
| Purity | > 95% as analyzed by SDS-PAGE. |
| Purification | > 95% as analyzed by SDS-PAGE. |
| Protein Sequence | APISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNTDVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQP YMQEVVPFLARLSNRLSTCHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI |
| MW | 16~28 kDa, observed by reducing SDS-PAGE. |
| Application notes | Reconstituted in ddH2O or PBS at 100 μg/ml. |
| Endotoxins | < 0.2 EU/μg, determined by LAL method. |
| Source | HEK 293 |
| Biological Activity | Active, measured by its ability to activate STAT following receptor ligand interaction. |
| Storage | Lyophilized recombinant Human Interleukin-22 (IL-22) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human Interleukin-22 (IL-22) should be stable up to 1 week at 4°C or up to 2 months at -20°C. |
| Alternative names | Interleukin-22, IL22 |
| Note | For research use only |
| Expiration Date | 6 months from date of receipt. |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review