RecombinantIL-1β,Human(CHO-expressed)

• Catalog Number: orb1494711
• Category: Proteins
• Description: Interleukin 1 beta is a proinflammatory cytokine produced in a variety of cells including monocytes, tissue macrophages, keratinocytes and other epithelial cells. Both IL-1 alpha and IL-1 beta binds to the same receptor and has similar if not identical biological properties. These cytokines have a broad range of activities including, stimulation of thymocyte proliferation, by inducing IL-2 release, B-cell maturation and proliferation, mitogenic FGF-like activity and the ability to stimulate the release of prostaglandin and collagenase from synovial cells. However, whereas IL-1 beta is a secreted cytokine, IL-1 alpha is predominantly a cell-associated cytokine.
• Form/Appearance: Lyophilized after extensive dialysis against PBS.
• Buffer/Preservatives: Lyophilized after extensive dialysis against PBS.
• Purity: > 95% as analyzed by SDS-PAGE and HPLC.
• Purification: > 95% as analyzed by SDS-PAGE and HPLC.
• Protein Sequence: APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTL QLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS
• MW: 17kDa, observed by non-reducing SDS-PAGE.
• Application notes: Reconstituted in ddH2O or PBS at 100 μg/ml.
• Endotoxins: < 0.2 EU/μg, determined by LAL method.
• Source: CHO
• Biological Activity: ED501 x 10ˆ8 units/mg.
• Storage: Lyophilized recombinant human Interleukin 1 beta (IL-1 beta) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, rhIL-1β should be stable up to 1 week at 4°C or up to 2 months at -20°C.
• Alternative names: Interleukin-1β; IL-1β; Catabolin, Lymphocyte-activ
• Note: For research use only
• Expiration Date: 6 months from date of receipt.