You have no items in your shopping cart.
You have no items in your shopping cart.

| Catalog Number | orb1494721 |
|---|---|
| Category | Proteins |
| Description | Interleukin-10 (IL-10), initially known as Cytokine Synthesis Inhibitory Factor (CSIF), belongs to the IL-10 family and shares more than 80% sequence homology with the Epstein-Barr Virus protein BCRFI. It is produced by many immune cells, such as T-cells, macrophages, mast cells and dendritic cells. It is usually secreted as a homodimer and, upon binding to its receptor, inhibits the synthesis of a number of cytokines, including IFN-gamma, IL-2, IL-3, TNF and GM-CSF produced by activated macrophages and Th2 cells. It also displays the ability to suppress Antigen-Presenting Cell (APC) function. The net effect of Interleukin-10 appears to be inhibitory; however, stimulatory effects, such as stimulation of B cell maturation and antibody production, are also reported. |
| Form/Appearance | Lyophilized after extensive dialysis against PBS. |
| Buffer/Preservatives | Lyophilized after extensive dialysis against PBS. |
| Purity | > 95% as analyzed by SDS-PAGE and HPLC. |
| Purification | > 95% as analyzed by SDS-PAGE and HPLC. |
| Protein Sequence | SKGHSIRGDNNCTHFPVSQTHMLRELRAAFSQVKTFFQKKDQLDNILLTDSLLQDFKGYLGCQALSEMIKFYLVEVMPQA ENHGPEIKEHLNSLGEKLKTLWIQLRRCHRFLPCENKSKAVEQVKNDFNKLQDKGVYKAMNEFDIFINCIEAYVTLKMKN |
| MW | 8-22 kDa, observed by reducing SDS-PAGE. |
| Application notes | Reconstituted in ddH2O or PBS at 100 μg/ml. |
| Endotoxins | < 0.2 EU/μg, determined by LAL method. |
| Source | CHO |
| Biological Activity | ED50 < 8μg /ml, measured in a bioassay using C6 cells. |
| Storage | Lyophilized recombinant rat Interleukin-10(IL-10) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Rat Interleukin-10 should be stable up to 1 week at 4°C or up to 2 months at -20°C. |
| Alternative names | Interleukin-10, IL10 |
| Note | For research use only |
| Expiration Date | 6 months from date of receipt. |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review