You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1494727 |
---|---|
Category | Proteins |
Description | Chemokine (C-C motif) ligand 1 (CCL1), also known as I-309, is a small glycoprotein secreted by activated T cells that belongs to the family of chemokines. Human CCL1 has been assumed to be a homologue of mouse TCA3. While the two proteins share only approximately 42% amino acid sequence identity, both chemokines contain an extra pair of cysteine residues not found in most other chemokines. CCL1 attracts monocytes, NK cells, immature B cells and dendritic cells by interacting with the cell surface chemokine receptor CCR8. This chemokine resides in a large cluster of CC chemokines on human chromosome 17.Recombinant Human I-309/CCL1 produced in CHO cells is a polypeptide chain containing 73 amino acids. A fully biologically active molecule, rhI-309/CCL1 has a molecular mass of 15kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript. |
Form/Appearance | Lyophilized after extensive dialysis against PBS. |
Buffer/Preservatives | Lyophilized after extensive dialysis against PBS. |
Purity | > 98% as analyzed by SDS-PAGE. |
Purification | > 98% as analyzed by SDS-PAGE. |
Protein Sequence | KSMQVPFSRCCFSFAEQEIPLRAILCYRNTSSICSNEGLIFKLKRGKEACALDTVGWVQR HRKMLRHCPSKRK |
MW | 15 kDa, observed by reducing SDS-PAGE. |
Application notes | Reconstituted in ddH2O or PBS at 100 μg/ml. |
Endotoxins | < 0.2 EU/μg, determined by LAL method. |
Source | CHO |
Biological Activity | The EC50 value of human I-309/CCL1 on Caˆ2+ mobilization assay in CHO-K1/ G15/hCCR8 cells (human G15 and human CCR8 stably expressed in CHO-K1 cells) is less than 1 μg/ml. |
Storage | Lyophilized recombinant Human I-309°CCL1 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, recombinant human I-309°CCL1 should be stable up to 1 week at 4°C or up to 2 months at -20°C. |
Alternative names | CCL1, TCA-3 |
Note | For research use only |