You have no items in your shopping cart.
Cart summary
Item 1 of 3
Item 1 of 3
Recombinant Rat Lymphocyte antigen 6 complex locus protein G6d (Ly6g6d) (Active)
Catalog Number: orb1785093
| Catalog Number | orb1785093 |
|---|---|
| Category | Proteins |
| Description | Recombinant Rat Lymphocyte antigen 6 complex locus protein G6d (Ly6g6d) (Active) |
| Tag | N-terminal 6xHis-tagged |
| Form/Appearance | Lyophilized powder |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| MW | 11.7 kDa |
| UniProt ID | Q6MG58 |
| Protein Sequence | QRMRCYDCGGGPSNSCKQTVITCGEGERCGFLDRKPQPSSEQAKQPSATLSHHYPACVATHHCNQVAIESVGDVTFTTQKNCCFGDLCN |
| Protein Length | Full Length of Mature Protein |
| Source | Yeast |
| Biological Origin | Rattus norvegicus (Rat) |
| Biological Activity | Measured by its binding ability in a functional ELISA. Immobilized Rat Ly6g6d at 5 μg/mL can bind Anti-LY6G6D recombinant antibody. The EC50 is 4.245-5.843 μg/mL. |
| Expression Region | 20-108aa |
| Endotoxins | Less than 1.0 EU/ug as determined by LAL method. |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
| Buffer/Preservatives | Lyophilized from a 0.2 μm sterile filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0 |
| Note | For research use only |
| Application notes | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Expiration Date | 6 months from date of receipt. |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Measured by its binding ability in a functional ELISA. Immobilized Rat Ly6g6d at 2 μg/ml can bind Anti-Ly6g6d recombinant antibody. The EC50 is 6.238-7.258 ng/mL.
The purity of Ly6g6d was greater than 95% as determined by SEC-HPLC
