You have no items in your shopping cart.
You have no items in your shopping cart.

| Catalog Number | orb1178939 |
|---|---|
| Category | Proteins |
| Description | Recombinant IL-36 gamma (Interleukin-36 gamma), Mouse, AF |
| Tag | His-tag at the N-terminus |
| Reactivity | Mouse |
| Form/Appearance | Lyophilized |
| Buffer/Preservatives | The protein was lyophilized from a solution containing 1X PBS, pH 7.4. |
| Purity | >98% as determined by SDS-PAGE. Ni-NTA chromatography. |
| Protein Sequence | MGRETPDFGEVFDLDQQVWIFRNQALVTVPRSHRVTPVSVTILPCKYPESLEQDKGIAIYLGIQNPDKCLFCKEVNGHPTLLLKEEKILDLYHHPEPMKPFLFYHTRTGGTSTFESVAFPGHYIASSKTGNPIFLTSKKGEYYNINFNLDIKS with polyhistidine tag at the C-terminus. |
| Tested applications | ELISA |
| Endotoxins | <0.1 EU per 1 μg of the protein by the LAL method. |
| Source | Escherichia coli |
| Biological Activity | Measure by its ability to induce IL-6 secretion in 3T3 cells. The ED50 for this effect is <15 ng/mL. The specific activity of recombinant mouse IL-36 gamma is > 6 x 104 IU/mg. |
| Storage | Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C. |
| Alternative names | interleukin 1 family, member 9, IL-1F9, IL-1ε (eps Read more... |
| Note | For research use only |
| Entrez | 215257 |
| Expiration Date | 6 months from date of receipt. |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review