You have no items in your shopping cart.
Cart summary
Recombinant Human Pro-epidermal growth factor (EGF), partial (Active)
Catalog Number: orb2657942
| Catalog Number | orb2657942 |
|---|---|
| Category | Proteins |
| Description | Recombinant Human Pro-epidermal growth factor (EGF), partial (Active) |
| Tag | Tag free |
| Form/Appearance | Lyophilized powder |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| MW | 6.2 kDa |
| UniProt ID | P01133 |
| Protein Sequence | NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR |
| Protein Length | Partial |
| Source | Mammalian cell |
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | Measured in a cell proliferation assay using NIH3T3 mouse embryonic fibroblast Cells. The ED50 for this effect ≤0.3 ng/mL. |
| Expression Region | 971-1023aa |
| Endotoxins | ≤10 EU/mg by the LAL method |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered solution containing PBS, 5% mannitoland 0.01% Tween 80, pH 7.4 |
| Alternative names | Pro-Epidermal Growth Factor; EGF; Epidermal Growth Read more... |
| Note | For research use only |
| Application notes | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Expiration Date | 6 months from date of receipt. |
- Item 1 of 1
Human EGF protein [orb594725]
Greater than 95% as determined by SDS-PAGE.
6.2 kDa
E.coli
10 μg, 50 μg, 500 μg, 1 mg
