You have no items in your shopping cart.
Cart summary
Item 1 of 2
Item 1 of 2
Recombinant Human Low affinity immunoglobulin gamma Fc region receptor III-A (FCGR3A)(F176V), partial (Active)
Catalog Number: orb1881660
| Catalog Number | orb1881660 |
|---|---|
| Category | Proteins |
| Description | Recombinant Human Low affinity immunoglobulin gamma Fc region receptor III-A (FCGR3A)(F176V), partial (Active) |
| Tag | C-terminal 10xHis-HSA-tagged |
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm sterile filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0 |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Protein Sequence | GMRTEDLPKAVVFLEPQWYRVLEKDSVTLKCQGAYSPEDNSTQWFHNESLISSQASSYFIDAATVDDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKGRKYFHHNSDFYIPKATLKDSGSYFCRGLVGSKNVSSETVNITITQGLAVSTISSFFPPGYQ |
| Protein Length | Partial |
| UniProt ID | P08637 |
| MW | 90.6 kDa |
| Application notes | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Endotoxins | Less than 1.0 EU/ug as determined by LAL method. |
| Source | Mammalian cell |
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | Loaded Anti-Human CD16a Antibody (CSB-RA008543MA1HU) on 96-Flat plate, can bind Human CD16a(F176V), with an affinity constant of 12 nM as determined in BLI assay (Gator Prime). |
| Expression Region | 17-208aa(F176V) |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
| Alternative names | CD16A |
| Note | For research use only |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Loaded Anti-Human CD16a Antibody on 96-Flat plate, can bind Human CD16a (F176V), with an affinity constant of 12 nM as determined in BLI assay (Gator Prime).
