You have no items in your shopping cart.
Cart summary
Item 1 of 3
Item 1 of 3
Recombinant Human Claudin-6(CLDN6)-Detergent (Active)
Catalog Number: orb2658573
| Catalog Number | orb2658573 |
|---|---|
| Category | Proteins |
| Description | Recombinant Human Claudin-6(CLDN6)-Detergent (Active) |
| Tag | N-terminal 10xHis-tagged and C-terminal Twin-Strep-tagged |
| Form/Appearance | Liquid |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| MW | 27.7 kDa |
| UniProt ID | P56747 |
| Protein Sequence | ASAGMQILGVVLTLLGWVNGLVSCALPMWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARALCVIALLVALFGLLVYLAGAKCTTCVEEKDSKARLVLTSGIVFVISGVLTLIPVCWTAHAIIRDFYNPLVAEAQKRELGASLYLGWAASGLLLLGGGLLCCTCPSGGSQGPSHYMARYSTSAPAISRGPSEYPTKNYV |
| Protein Length | Partial |
| Source | Mammalian cell |
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | Measured by its binding ability in a functional ELISA. Immobilized Human CLDN6 at 2 μg/mL on an Nickel Coated plate can bind Anti-CLDN6/9 recombinant antibody (CSB-RA005508MA1HU). The EC50 is 0.6949-1.158 ng/mL. |
| Expression Region | 2-220aa |
| Endotoxins | Less than 1.0 EU/ug as determined by LAL method. |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
| Buffer/Preservatives | 50 mM HEPES, 0.15 M NaCl, 0.05% DDM, 0.01% CHS, pH 7.5 |
| Alternative names | UNQ757; PRO1488 Read more... |
| Note | For research use only |
| Expiration Date | 6 months from date of receipt. |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Measured by its binding ability in a functional ELISA. Immobilized Human CLDN6 at 2 μg/ml on an Nickel Coated plate can bind Anti-CLDN6/9 recombinant antibody. The EC50 is 0.6949-1.158 ng/mL.
Human CLDN6 Monoclonal Antibody captured on Protein A Chip can bind Human CLDN6 Full Length Protein with an affinity constant of 5.43 nM as detected by MetaSPR Assay (in presence of DDM/CHS) (WeSPRTM200).
