Recombinant Human Claudin-6(CLDN6)-Detergent (Active)

• Catalog Number: orb2658573
• Category: Proteins
• Description: Recombinant Human Claudin-6(CLDN6)-Detergent (Active)
• Tag: N-terminal 10xHis-tagged and C-terminal Twin-Strep-tagged
• Form/Appearance: Liquid
• Buffer/Preservatives: 50 mM HEPES, 0.15 M NaCl, 0.05% DDM, 0.01% CHS, pH 7.5
• Purity: Greater than 90% as determined by SDS-PAGE.
• Protein Sequence: ASAGMQILGVVLTLLGWVNGLVSCALPMWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARALCVIALLVALFGLLVYLAGAKCTTCVEEKDSKARLVLTSGIVFVISGVLTLIPVCWTAHAIIRDFYNPLVAEAQKRELGASLYLGWAASGLLLLGGGLLCCTCPSGGSQGPSHYMARYSTSAPAISRGPSEYPTKNYV
• Protein Length: Partial
• UniProt ID: P56747
• MW: 27.7 kDa
• Endotoxins: Less than 1.0 EU/ug as determined by LAL method.
• Source: Mammalian cell
• Biological Origin: Homo sapiens (Human)
• Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized Human CLDN6 at 2 μg/mL on an Nickel Coated plate can bind Anti-CLDN6/9 recombinant antibody. The EC50 is 0.6949-1.158 ng/mL.
• Expression Region: 2-220aa
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
• Alternative names: UNQ757; PRO1488
• Research Area: Cancer Biology
• Note: For research use only

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Measured by its binding ability in a functional ELISA. Immobilized Human CLDN6 at 2 μg/ml on an Nickel Coated plate can bind Anti-CLDN6/9 recombinant antibody. The EC50 is 0.6949-1.158 ng/mL.

Human CLDN6 Monoclonal Antibody captured on Protein A Chip can bind Human CLDN6 Full Length Protein with an affinity constant of 5.43 nM as detected by MetaSPR Assay (in presence of DDM/CHS) (WeSPRTM200).