Recombinant Human C-C chemokine receptor type 9 (CCR9)-VLPs (Active)

• Catalog Number: orb1785015
• Category: Proteins
• Description: Recombinant Human C-C chemokine receptor type 9 (CCR9)-VLPs (Active)
• Tag: C-terminal 10xHis-tagged (This tag can be tested only under denaturing conditions)
• Form/Appearance: Lyophilized powder
• Buffer/Preservatives: Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
• Protein Sequence: MTPTDFTSPIPNMADDYGSESTSSMEDYVNFNFTDFYCEKNNVRQFASHFLPPLYWLVFIVGALGNSLVILVYWYCTRVKTMTDMFLLNLAIADLLFLVTLPFWAIAAADQWKFQTFMCKVVNSMYKMNFYSCVLLIMCISVDRYIAIAQAMRAHTWREKRLLYSKMVCFTIWVLAAALCIPEILYSQIKEESGIAICTMVYPSDESTKLKSAVLTLKVILGFFLPFVVMACCYTIIIHTLIQAKKSSKHKALKVTITVLTVFVLSQFPYNCILLVQTIDAYAMFISNCAVSTNIDICFQVTQTIAFFHSCLNPVLYVFVGERFRRDLVKTLKNLGCISQAQWVSFTRREGSLKLSSMLLETTSGALSL
• Protein Length: Full Length
• UniProt ID: P51686
• MW: 43.4 kDa
• Application notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80℃. Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing.
• Endotoxins: Less than 1.0 EU/ug as determined by LAL method.
• Source: Mammalian cell
• Biological Origin: Homo sapiens (Human)
• Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized Human CCR9 at 10 μg/mL can bind Anti-CCR9 recombinant antibody. The EC50 is 31.67-36.83 ng/mL. The VLPs is negative control.
• Expression Region: 1-369aa
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
• Alternative names: C-C CKR-9; CC-CKR-9; CCR-9;G-protein coupled recep
• Research Area: Immunology & Inflammation
• Note: For research use only
• Expiration Date: 6 months from date of receipt.

Detected by Mouse anti-6*His monoclonal antibody.

The purity of VLPs was greater than 95% as determined by HPLC-SEC.

Measured by its binding ability in a functional ELISA. Immobilized Human CCR9 at 10μg/mL can bind Anti-CCR9 recombinant antibody, the EC50 is 31.67-36.83 ng/mL.The VLPs is negative control.