You have no items in your shopping cart.
Cart summary
Item 1 of 3
Item 1 of 3
Recombinant Human C-C chemokine receptor type 9 (CCR9)-VLPs (Active)
Catalog Number: orb1785015
| Catalog Number | orb1785015 |
|---|---|
| Category | Proteins |
| Description | Recombinant Human C-C chemokine receptor type 9 (CCR9)-VLPs (Active) |
| Tag | C-terminal 10xHis-tagged (This tag can be tested only under denaturing conditions) |
| Form/Appearance | Lyophilized powder |
| MW | 43.4 kDa |
| UniProt ID | P51686 |
| Protein Sequence | MTPTDFTSPIPNMADDYGSESTSSMEDYVNFNFTDFYCEKNNVRQFASHFLPPLYWLVFIVGALGNSLVILVYWYCTRVKTMTDMFLLNLAIADLLFLVTLPFWAIAAADQWKFQTFMCKVVNSMYKMNFYSCVLLIMCISVDRYIAIAQAMRAHTWREKRLLYSKMVCFTIWVLAAALCIPEILYSQIKEESGIAICTMVYPSDESTKLKSAVLTLKVILGFFLPFVVMACCYTIIIHTLIQAKKSSKHKALKVTITVLTVFVLSQFPYNCILLVQTIDAYAMFISNCAVSTNIDICFQVTQTIAFFHSCLNPVLYVFVGERFRRDLVKTLKNLGCISQAQWVSFTRREGSLKLSSMLLETTSGALSL |
| Protein Length | Full Length |
| Source | Mammalian cell |
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | Measured by its binding ability in a functional ELISA. Immobilized Human CCR9 at 10 μg/mL can bind Anti-CCR9 recombinant antibody (CSB-RA004848MA1HU). The EC50 is 31.67-36.83 ng/mL.The VLPs (CSB-MP3838) is negative control. |
| Expression Region | 1-369aa |
| Endotoxins | Less than 1.0 EU/ug as determined by LAL method. |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
| Buffer/Preservatives | Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4 |
| Alternative names | C-C CKR-9; CC-CKR-9; CCR-9;G-protein coupled recep Read more... |
| Note | For research use only |
| Application notes | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80℃. Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing. |
| Expiration Date | 6 months from date of receipt. |
Detected by Mouse anti-6*His monoclonal antibody.
The purity of VLPs was greater than 95% as determined by HPLC-SEC.
Measured by its binding ability in a functional ELISA. Immobilized Human CCR9 at 10μg/mL can bind Anti-CCR9 recombinant antibody, the EC50 is 31.67-36.83 ng/mL.The VLPs is negative control.
