You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2904012 |
---|---|
Category | Proteins |
Description | Recombinant Cricetulus griseus Phosphatidylserine synthase 2(PTDSS2) |
Form/Appearance | Lyophilized powder |
Buffer/Preservatives | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Protein Sequence | MRRAERRVAGGSGSGSPLLEGRRSTESEVYDDGTNTFFWRAHTLTVLFILTCSLGYVTLL EETPQDTAYNTKRGIVASILVFLCFGVTQAKDGPFSRPHPAYWRFWLCVSVVYELFLIFI LFQTVQDGRQFLKYVDPRLGVPLPERDYGGNCLIYDADNKTDPFHNIWDKLDGFVPAHFI GWYLKTLMIRDWWMCMIISVMFEFLEYSLEHQLPNFSECWWDHWIMDVLICNGLGIYCGM KTLEWLSLKTYKWQGLWNIPTYKGKMKRIAFQFTPYSWVRFEWKPASSLHRWLAVCGIIL VFLLAELNTFYLKFVLWMPPEHYLVLLRLVFFVNVGGVAMREIYDFMDELKPHRKLGQQA WLVAAITVTELLIVVKYDPHTLTLSLPFYISQCWTLGSILVLTWTVWRFFLRDITMRYKE TRRQKQQSHQGRAINNGDGHPGPDDDLLGTGTAEEEGSTNDSVPAEKEGASAAS |
Protein Length | full length protein |
UniProt ID | O08888 |
Biological Origin | Cricetulus griseus (Chinese hamster) (Cricetulus barabensis griseus) |
Expression Region | 1-474 |
Storage | Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week |
Alternative names | Phosphatidylserine synthase 2, PSS-2, PtdSer synth Read more... |
Note | For research use only |