Cart summary

You have no items in your shopping cart.

Recombinant Arabidopsis thaliana Ubiquitin-conjugating enzyme E2 32(UBC32)

Recombinant Arabidopsis thaliana Ubiquitin-conjugating enzyme E2 32(UBC32)

Catalog Number: orb2926827

DispatchUsually dispatched within 15-40 working days
$ 1,950.00
Catalog Numberorb2926827
CategoryProteins
DescriptionRecombinant Arabidopsis thaliana Ubiquitin-conjugating enzyme E2 32(UBC32)
Form/AppearanceLyophilized powder
Buffer/PreservativesTris/PBS-based buffer, 6% Trehalose, pH 8.0
ReconstitutionWe recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Protein SequenceMADERYNRKNPAVKRILQEVKEMQANPSDDFMSLPLEENIFEWQFAIRGPGDTEFEGGIY HGRIQLPADYPFKPPSFMLLTPNGRFETNTKICLSISNYHPEHWQPSWSVRTALVALIAF MPTSPNGALGSVDYPKDERRTLAIKSRETPPKYGSPERQKIIDEIHQYILSKATVVPKPL PLECSQAPSIVSEAHSQVEPQEAITVVEERSIATTDTIVDDQIIEETAEAVNTAASVVPA AAPLPAVEVVVKASVSGEQRMARRAAQKPVDDRLFTWAAVGLTIAIMVLLLKKFIKSNGY STGFMDDQS
Protein Lengthfull length protein
UniProt IDQ9LSP7
Biological OriginArabidopsis thaliana (Mouse-ear cress)
Expression Region1-309
StorageStorage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Alternative namesUbiquitin-conjugating enzyme E2 32, EC= 6.3.2.19,
Read more...
NoteFor research use only