You have no items in your shopping cart.
Cart summary
Item 1 of 1
Rat Vegfa protein
Catalog Number: orb604448
| Catalog Number | orb604448 |
|---|---|
| Category | Proteins |
| Description | Recombinant Rat Vascular endothelial growth factor A(Vegfa) |
| Tag | N-terminal 6xHis-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Protein Sequence | APTTEGEQKAHEVVKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNVTMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPEKKSVRGKGKGQKRKRKKSRFKSWSVHCEPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR |
| Protein Length | Full Length of Mature Protein |
| UniProt ID | P16612 |
| MW | 26.1 kDa |
| Application notes | Full Length of Mature Protein |
| Endotoxins | Not test. |
| Source | E.coli |
| Biological Origin | Rattus norvegicus (Rat) |
| Expression Region | 27-214aa |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Alternative names | Vascular permeability factor , VPF |
| Note | For research use only |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Rat VEGFA protein [orb392698]
ELISA, MS, SDS-PAGE, WB
Greater than 95% as determined by reducing SDS-PAGE.
P. pastoris
10 μg, 50 μg, 500 μgRecombinant Rat VEGFA Protein, N-His [orb2831566]
> 90% as determined by SDS-PAGE.
24.37 kDa
100 μg, 50 μg, 20 μgRat VEGFA Protein [orb2698640]
> 86%, determined by SDS-PAGE
This protein contains the rat VEGF 164 isoform (AAA41211.1) (Met 1-Arg 190) was expressed.
20 μg, 5 μgRecombinant Rat VEGFA/VEGF164 Protein, His Tag [orb1550607]
> 95% by SDS-PAGE.
Recombinant Rat VEGFA/VEGF164 Protein is produced by HEK293 Cells expression system. The target protein is expressed with sequence (Ala27-Arg190) of Rat VEGFA (Accession #NP_001274037.1) fused with an 6��His Tag at the C-terminus.
100 μg, 50 μg
