You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb604448 |
---|---|
Category | Proteins |
Description | Recombinant Rat Vascular endothelial growth factor A(Vegfa) |
Tag | N-terminal 6xHis-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Protein Sequence | APTTEGEQKAHEVVKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNVTMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPEKKSVRGKGKGQKRKRKKSRFKSWSVHCEPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR |
Protein Length | Full Length of Mature Protein |
UniProt ID | P16612 |
MW | 26.1 kDa |
Application notes | Full Length of Mature Protein |
Endotoxins | Not test. |
Source | E.coli |
Biological Origin | Rattus norvegicus (Rat) |
Expression Region | 27-214aa |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Alternative names | Vascular permeability factor , VPF |
Note | For research use only |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
ELISA, MS, SDS-PAGE, WB | |
Greater than 95% as determined by reducing SDS-PAGE. | |
P. pastoris |
> 90% as determined by SDS-PAGE. | |
24.37 kDa |
> 86%, determined by SDS-PAGE | |
This protein contains the rat VEGF 164 isoform (AAA41211.1) (Met 1-Arg 190) was expressed. |
> 95% by SDS-PAGE. | |
Recombinant Rat VEGFA/VEGF164 Protein is produced by HEK293 Cells expression system. The target protein is expressed with sequence (Ala27-Arg190) of Rat VEGFA (Accession #NP_001274037.1) fused with an 6��His Tag at the C-terminus. |