PTX3 monoclonal antibody (M02), clone 2B10

• Catalog Number: orb2292297
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant PTX3.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 2B10
• Tested applications: ELISA, IF, WB
• Reactivity: Human, Rat
• Isotype: IgG2a Kappa
• Immunogen: PTX3 (NP_002843, 282 a.a. ~ 380 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: SLWVNGELAATTVEMATGHIVPEGGILQIGQEKNGCCVGGGFDETLAFSGRLTGFNIWDSVLSNEEIRETGGAESCHIRGNIVGWGVTEIQPHGGAQYV
• NCBI: NP_002843
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged PTX3 is approximately 0.03 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to PTX3 on HeLa cell. [antibody concentration 10 ug/ml]

PTX3 monoclonal antibody (M02), clone 2B10. Western Blot analysis of PTX3 expression in U-2 OS.

Western Blot detection against Immunogen (36.63 KDa).