Cart summary

You have no items in your shopping cart.

PRMT1 Rabbit Polyclonal Antibody (FITC)

PRMT1 Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2126103

DispatchUsually dispatched within 5-10 working days
$ 620.00
Catalog Numberorb2126103
CategoryAntibodies
DescriptionPRMT1 Rabbit Polyclonal Antibody (FITC)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsIHC, WB
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human PRMT1
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationFITC
MW40kDa
UniProt IDQ99873
Protein SequenceSynthetic peptide located within the following region: ESMLNTVLYARDKWLAPDGLIFPDRATLYVTAIEDRQYKDYKIHWWENVY
NCBINP_001527
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namesANM1, HCP1, IR1B4, HRMT1L2
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.