Primate IFN gamma protein

• Catalog Number: orb419314
• Category: Proteins
• Description: Recombinant Rhesus Macaque Interferon gamma active
• Tag: Tag-Free
• Form/Appearance: Lyophilized powder
• Buffer/Preservatives: Lyophilized from a 0.2 µm filtered PBS, pH 7.4
• Purity: > 97% as determined by SDS-PAGE and HPLC.
• Protein Sequence: QDPYVKEAENLKKYFNAGDPDVADNGTLFLDILRNWKEESDRKIMQSQIVSFYFKLFKNFKDDQRIQKSVETIKEDINVKFFNSNKKKRDDFEKLTNYSVTDSNVQRKAVHELIQVMAELSPAAKIGKRKRSQMFRGRRASQ
• Protein Length: Full Length of Mature Protein
• UniProt ID: P63310
• MW: 16.8 kDa
• Application notes: Tag Info: NO-taggedExpression Region: 24-165aaSequence Info: Full Length of Mature Protein
• Endotoxins: Less than 1.0 EU/µg as determined by LAL method.
• Source: E.Coli
• Biological Origin: Macaca mulatta (Rhesus macaque)
• Biological Activity: Fully biologically active when compared to standard. The ED50 as determined by an anti-viral assay using human HeLa cells infected with encephalomyocarditis (EMC) virus is less than 20.0 ng/ml, corresponding to a specific activity of ＞ 5.0 ×104 IU/mg.
• Expression Region: 24-165aa
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Alternative names: IFN-gamma,
• Research Area: Immunology & Inflammation
• Note: For research use only