PPOX monoclonal antibody (M01), clone 2F10

• Catalog Number: orb2292361
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant PPOX.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 2F10
• Tested applications: ELISA, IHC-P, WB
• Reactivity: Human
• Isotype: IgG1 Kappa
• Immunogen: PPOX (AAH02357, 378 a.a. ~ 477 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: EASGCVLSQELFQQRAQEAAATQLGLKEMPSHCLVHLHKNCIPQYTLGHWQKLESARQFLTAHRLPLTLAGASYEGVAVNDCIESGRQAAVSVLGTEPNS
• NCBI: AAH02357
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged PPOX is approximately 0.1 ng/ml as a capture antibody.

Immunoperoxidase of monoclonal antibody to PPOX on formalin-fixed paraffin-embedded human lung, adenosquamous cell carcinoma. [antibody concentration 3 ug/ml]

Western Blot analysis of PPOX expression in transfected 293T cell line by PPOX monoclonal antibody (M01), clone 2F10. Lane 1: PPOX transfected lysate (50.8 KDa). Lane 2: Non-transfected lysate.

Western blot analysis of PPOX over-expressed 293 cell line, cotransfected with PPOX Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with PPOX monoclonal antibody (M01), clone 2F10 (Cat # orb2292361). GAPDH (36.1 kDa) used as specificity and loading control.

Western Blot detection against Immunogen (36.74 KDa).