You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2292361 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant PPOX. |
Species/Host | Mouse |
Clonality | Monoclonal |
Clone Number | 2F10 |
Tested applications | ELISA, IHC-P, WB |
Reactivity | Human |
Isotype | IgG1 Kappa |
Immunogen | PPOX (AAH02357, 378 a.a. ~ 477 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Conjugation | Unconjugated |
Protein Sequence | EASGCVLSQELFQQRAQEAAATQLGLKEMPSHCLVHLHKNCIPQYTLGHWQKLESARQFLTAHRLPLTLAGASYEGVAVNDCIESGRQAAVSVLGTEPNS |
NCBI | AAH02357 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Detection limit for recombinant GST tagged PPOX is approximately 0.1 ng/ml as a capture antibody.
Immunoperoxidase of monoclonal antibody to PPOX on formalin-fixed paraffin-embedded human lung, adenosquamous cell carcinoma. [antibody concentration 3 ug/ml]
Western Blot analysis of PPOX expression in transfected 293T cell line by PPOX monoclonal antibody (M01), clone 2F10. Lane 1: PPOX transfected lysate (50.8 KDa). Lane 2: Non-transfected lysate.
Western blot analysis of PPOX over-expressed 293 cell line, cotransfected with PPOX Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with PPOX monoclonal antibody (M01), clone 2F10 (Cat # orb2292361). GAPDH (36.1 kDa) used as specificity and loading control.
Western Blot detection against Immunogen (36.74 KDa).