You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb579658 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to PPAT |
Target | PPAT |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Rabbit, Rat |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human PPAT |
Protein Sequence | Synthetic peptide located within the following region: VTSDGSSVPTFKSHKGMGLVNHVFTEDNLKKLYVSNLGIGHTRYATTGKC |
UniProt ID | Q06203 |
MW | 57 kDa |
Tested applications | IHC, WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | GPAT, PRAT, ATASE |
Note | For research use only |
NCBI | NP_002694 |
Sample Type: 1. Human Skin Fibroblasts (100 ug), 2. HepG2 cells (20 ug), 3. HEK273 cells (20 ug), 4. HeLa skin cells(20 ug), 5. Hamster CHO K1 cells (20 ug), Primary dilution: 1:5000, Secondary Antibody: Clean-Blot IP detection Reagent and Kit, Secondary dilution: 1:2000.
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment.
Sample Tissue: Human 293T Whole Cell, Antibody dilution: 1 ug/ml.
Human kidney
PPAT antibody - N-terminal region (orb579658) validated by WB using HepG2 Cell Lysate at 0.25 ug/ml. PPAT is supported by BioGPS gene expression data to be expressed in HepG2.
WB | |
Canine, Equine, Mouse, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
IH, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC-Fr, IHC-P | |
Bovine, Canine, Equine, Gallus, Human, Porcine, Rabbit, Sheep | |
Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |