You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1976780 |
---|---|
Category | Proteins |
Description | During the asexual blood stage, catalyzes the initial cleavage of native host hemoglobin (Hb) resulting in Hb denaturation; specifically cleaves between Phe-33 and Leu-34 of Hb alpha-chain. Digestion of host Hb is an essential step which provides the parasite with amino acids for protein synthesis, and regulates osmolarity (Probable). Plasmepsin-1 Protein, Plasmodium falciparum, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 41.0 kDa and the accession number is P39898. |
Tag | N-6xHis |
Purity | 98.00% |
Protein Sequence | AGDSVTLNDVANVMYYGEAQIGDNKQKFAFIFDTGSANLWVPSAQCNTIGCKTKNLYDSNKSKTYEKDGTKVEMNYVSGTVSGFFSKDIVTIANLSFPYKFIEVTDTNGFEPAYTLGQFDGIVGLGWKDLSIGSVDPVVVELKNQNKIEQAVFTFYLPFDDKHKGYLTIGGIEDRFYEGQLTYEKLNHDLYWQVDLDLHFGNLTVEKATAIVDSGTSSITAPTEFLNKFFEGLDVVKIPFLPLYITTCNNPKLPTLEFRSATNVYTLEPEYYLQQIFDFGISLCMVSIIPVDLNKNTFILGDPFMRKYFTVFDYDNHTVGFALAKKKL |
UniProt ID | P39898 |
MW | 41.0 kDa (predicted) |
Application notes | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
Expression System | E. coli |
Biological Origin | Plasmodium falciparum |
Biological Activity | During the asexual blood stage, catalyzes the initial cleavage of native host hemoglobin (Hb) resulting in Hb denaturation; specifically cleaves between Phe-33 and Leu-34 of Hb alpha-chain. Digestion of host Hb is an essential step which provides the parasite with amino acids for protein synthesis, and regulates osmolarity (Probable). Plasmepsin-1 Protein, Plasmodium falciparum, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 41.0 kDa and the accession number is P39898. |
Expression Region | 125-452 aa |
Storage | -20°C |
Note | For research use only |