You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2693896 |
---|---|
Category | Proteins |
Description | PHI-27 (porcine) is a 27 amino acid peptide.PHI-27 (porcine) is used to find peptide hormones and other active peptides. |
CAS Number | 80458-29-3 |
Purity | ≥95% |
MW | 2995.4 |
Formula | C136H216N36O40 |
Target | others |
Protein Sequence | HADGVFTSDFSRLLGQLSAKKYLESLI-NH2 |
Note | For research use only |
Expiration Date | 6 months from date of receipt. |