PEA15 Rabbit Polyclonal Antibody

• Catalog Number: orb580342
• Category: Antibodies
• Description: Rabbit polyclonal antibody to PEA15
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PEA15
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 15kDa
• Target: PEA15
• UniProt ID: Q15121
• Protein Sequence: Synthetic peptide located within the following region: DLLTMVVDYRTRVLKISEEDELDTKLTRIPSAKKYKDIIRQPSEEEIIKL
• NCBI: NP_003759
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: PED, MAT1, HMAT1, MAT1H, PEA-15, HUMMAT1H, PED-PEA
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Rabbit Anti-PEA15 Antibody, Catalog Number: orb580342, Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue, Observed Staining: Cytoplasmic, Primary Antibody Concentration: 1:100, Other Working Concentrations: N/A, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-PEA15 Antibody, Positive Control: Lane 1: 20 ug EGFP-transfected MCF7 lysate, Lane 2: 20 ug EGFP-PEA15 transfected MCF7 lysate, Primary Antibody Dilution: 1:1000, Secondary Antibody: Goat anti-rabbit-HRP, Secondry Antibody Dilution: 1:5000.

WB Suggested Anti-PEA15 Antibody Titration: 0.2-1 ug/ml, Positive Control: 721_B cell lysate.