You have no items in your shopping cart.
Cart summary
PCBP1 Peptide - middle region
Catalog Number: orb2005965
| Catalog Number | orb2005965 |
|---|---|
| Category | Proteins |
| Description | PCBP1 Peptide - middle region |
| Predicted Reactivity | Human |
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized powder |
| Protein Sequence | PHATHDLEGPPLDAYSIQGQHTISPLDLAKLNQVARQQSHFAMMHGGTGF |
| UniProt ID | Q15365 |
| MW | 37kDa |
| Tested applications | IHC, WB |
| Application notes | This is a synthetic peptide designed for use in combination with PCBP1 Rabbit Polyclonal Antibody (orb330139). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. |
| Storage | Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles. |
| Alternative names | HNRPE1, HNRPX, hnRNP-E1, hnRNP-X |
| Note | For research use only |
| NCBI | NP_006187 |
| Expiration Date | 6 months from date of receipt. |
