You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb330138 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to PCBP1 |
Target | PCBP1 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human, Mouse |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Rabbit, Rat |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 1.0 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human PCBP1 |
Protein Sequence | Synthetic peptide located within the following region: CSDAVGYPHATHDLEGPPLDAYSIQGQHTISPLDLAKLNQVARQQSHFAM |
UniProt ID | Q15365 |
MW | 39kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | anti HNRPX antibody, anti HNRPE1 antibody, anti hn Read more... |
Note | For research use only |
NCBI | NP_006187 |
Expiration Date | 12 months from date of receipt. |
Sample Tissue: Mouse Brain, Antibody Dilution: 1 ug/mL.
Sample Type: HepG2, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 2.5 ug/mL, Peptide Concentration: 2.0 ug/mL, Lysate Quantity: 25 ug/lane, Gel Concentration: 12%. PCBP1 is supported by BioGPS gene expression data to be expressed in HepG2.
WB Suggested Anti-PCBP1 Antibody Titration: 1.25 ug/mL, Positive Control: HepG2 cell lysate, PCBP1 is supported by BioGPS gene expression data to be expressed in HepG2.
IHC, WB | |
Bovine, Canine, Equine, Guinea pig, Rabbit, Rat | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, WB | |
Human, Mouse, Rabbit, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC, WB | |
Mouse, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |