You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb579340 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to D4S234E |
Target | NSG1 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Guinea pig, Mouse, Rabbit, Rat |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human D4S234E |
Protein Sequence | Synthetic peptide located within the following region: MVKLGNNFAEKGTKQPLLEDGFDTIPLMTPLDVNQLQFPPPDKVVVKTKT |
UniProt ID | P42857 |
MW | 21kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | P21, D4S234, NEEP21, D4S234E |
Note | For research use only |
NCBI | NP_001035190 |
WB Suggested Anti-D4S234E Antibody Titration: 0.2-1 ug/ml, Positive Control: COLO205 cell lysate.
IF, IHC-Fr, IHC-P, WB | |
Bovine, Canine, Equine, Gallus, Human, Porcine, Rabbit, Sheep | |
Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF | |
Bovine, Canine, Equine, Gallus, Human, Porcine, Rabbit, Sheep | |
Mouse, Rat | |
Rabbit | |
Polyclonal | |
Cy5 |
IHC-Fr, IHC-P, WB | |
Bovine, Canine, Equine, Gallus, Human, Porcine, Rabbit, Sheep | |
Mouse, Rat | |
Rabbit | |
Polyclonal | |
AP |
IF | |
Bovine, Canine, Equine, Gallus, Human, Porcine, Rabbit, Sheep | |
Mouse, Rat | |
Rabbit | |
Polyclonal | |
PE/Cy5.5 |