You have no items in your shopping cart.
Cart summary
NikR Protein, E. coli, Recombinant (His)
Catalog Number: orb1979253
| Catalog Number | orb1979253 |
|---|---|
| Category | Proteins |
| Description | Transcriptional repressor of the nikABCDE operon. Is active in the presence of excessive concentrations of intracellular nickel. |
| Tag | N-6xHis |
| Purity | 98.00% |
| MW | 19.1 kDa (predicted) |
| UniProt ID | P0A6Z6 |
| Protein Sequence | MQRVTITLDDDLLETLDSLSQRRGYNNRSEAIRDILRSALAQEATQQHGTQGFAVLSYVYEHEKRDLASRIVSTQHHHHDLSVATLHVHINHDDCLEIAVLKGDMGDVQHFADDVIAQRGVRHGHLQCLPKED |
| Expression System | E. coli |
| Biological Origin | E. coli |
| Biological Activity | Transcriptional repressor of the nikABCDE operon. Is active in the presence of excessive concentrations of intracellular nickel. |
| Expression Region | 1-133 aa |
| Storage | -20°C |
| Note | For research use only |
| Application notes | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Expiration Date | 6 months from date of receipt. |
