NDRG2 monoclonal antibody (M03), clone 6A5

• Catalog Number: orb2290938
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant NDRG2.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 6A5
• Tested applications: ELISA, WB
• Reactivity: Human
• Isotype: IgG1 Kappa
• Immunogen: NDRG2 (NP_057334, 1 a.a. ~ 96 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: MAELQEVQITEEKPLLPGQTPEAAKTHSVETPYGSVTFTVYGTPKPKRPAILTYHDVGLNYKSCFQPLFQFEDMQEIIQNFVRVHVDAPGMEEGAP
• NCBI: NP_057334
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged NDRG2 is approximately 0.03 ng/ml as a capture antibody.

NDRG2 monoclonal antibody (M03), clone 6A5. Western Blot analysis of NDRG2 expression in Hela S3 NE.

Western Blot analysis of NDRG2 expression in transfected 293T cell line by NDRG2 monoclonal antibody (M03), clone 6A5. Lane 1: NDRG2 transfected lysate(39.7 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (36.3 KDa).