NCOA4 monoclonal antibody (M04), clone 1B7

• Catalog Number: orb2291918
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant NCOA4.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG1 Kappa
• Conjugation: Unconjugated
• Reactivity: Human, Mouse
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: NCOA4 (NP_005428, 505 a.a. ~ 614 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: EGSPKEVPGTEDRAGKQKFKSPMNTSWCSFNTADWVLPGKKMGNLSQLSSGEDKWLLRKKAQEVLLNSPLQEEHNFPPDHYGLPAVCDLFACMQLKVDKEKWLYRTPLQM
• Tested applications: ELISA, IF, WB
• Clone Number: 1B7
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: NP_005428

Detection limit for recombinant GST tagged NCOA4 is approximately 3 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to NCOA4 on NIH/3T3 cell. [antibody concentration 10 ug/ml]

NCOA4 monoclonal antibody (M04), clone 1B7 Western Blot analysis of NCOA4 expression in NIH/3T3.

Western Blot detection against Immunogen (37.84 KDa).