You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1978247 |
---|---|
Category | Proteins |
Description | Metallothioneins have a high content of cysteine residues that bind various heavy metals; these proteins are transcriptionally regulated by both heavy metals and glucocorticoids. |
Tag | N-6xHis |
Purity | 98.00% |
Protein Sequence | MDPNCSCAAGDSCTCAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGASDKCSC |
UniProt ID | P02795 |
MW | 7.9 kDa (predicted) |
Application notes | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
Expression System | P. pastoris (Yeast) |
Biological Origin | Human |
Biological Activity | Metallothioneins have a high content of cysteine residues that bind various heavy metals; these proteins are transcriptionally regulated by both heavy metals and glucocorticoids. |
Expression Region | 1-59 aa |
Storage | -20°C |
Note | For research use only |