You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb418986 |
---|---|
Category | Proteins |
Description | Recombinant Mouse Transthyretin |
Tag | N-terminal GST-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Purity | Greater than 90% as determined by SDS-PAGE. |
MW | 40.5 kDa |
UniProt ID | P07309 |
Protein Sequence | AGAGESKCPLMVKVLDAVRGSPAVDVAVKVFKKTSEGSWEPFASGKTAESGELHGLTTDEKFVEGVYRVELDTKSYWKTLGISPFHEFADVVFTANDSGHRHYTIAALLSPYSYSTTAVVSNPQN |
Protein Length | Partial |
Source | E.coli |
Biological Origin | Mus musculus (Mouse) |
Expression Region | 23-147aa |
Endotoxins | Not test. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Alternative names | Prealbumin Read more... |
Note | For research use only |
Application notes | Tag Info: N-terminal GST-taggedExpression Region: 23-147aaSequence Info: Partial |
Expiration Date | 6 months from date of receipt. |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
IF, IHC-Fr, IHC-P, WB | |
Human | |
Mouse | |
Monoclonal | |
Unconjugated |
IF, IHC-Fr, IHC-P | |
Human | |
Mouse | |
Monoclonal | |
Unconjugated |
Greater than 95% as determined by SDS-PAGE. | |
16.4 kDa | |
Mammalian cell |
Greater than 90% as determined by SDS-PAGE. | |
29.5 kDa | |
E.coli |
Greater than 90% as determined by SDS-PAGE. | |
13.5 kDa | |
E.coli |