You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb427377 |
---|---|
Category | Proteins |
Description | Mouse Noggin protein |
Form/Appearance | Sterile Filtered White lyophilized (freeze-dried) powder. |
Purity | Greater than 95.0% as determined by SDS-PAGE. |
Solubility (25°C) | It is recommended to be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in 10mM HAc to a concentration of 0.1-1.0 mg/ml. Further dilutions should be made in appropriate buffered solutions. |
Protein Sequence | MQHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGPAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGQRCGWIPIQYPIISECKCSC |
Source | Escherichia Coli |
Biological Activity | The ED50 as determined by inhibiting BMP-4-induced alkaline phosphatase production of murine ATDC5 cells is less than 2ng/ml, corresponding to a specific activity of > 5.0 × 105 IU/mg in the presence of 5ng/ml BMP-4. |
Storage | Stability: Lyophilized Mouse Noggin although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Mouse Noggin should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles |
Buffer/Preservatives | Lyophilized from a 0.2μm filtered solution in 30% acetonitrile, 0.1% TFA. |
Alternative names | Noggin, SYM1, SYNS1, NOG. Read more... |
Note | For research use only |
Application notes | Cytokines And Growth Factors |
Expiration Date | 6 months from date of receipt. |
ELISA, MS, SDS-PAGE, WB | |
Greater than 95% as determined by reducing SDS-PAGE. | |
Human cells |
> 99.9% | |
30 KDa (reducing condition) |
98.00% | |
25.16 kDa (predicted). Due to glycosylation, the protein migrates to 28-38 kDa based on Tris-Bis PAGE result. |
> 95% | |
23.07 kDa (predicted). Due to glycosylation, the protein migrates to 28-33 kDa based on Tris-Bis PAGE result. |